PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.15G019100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 775aa    MW: 87260.5 Da    PI: 6.1416
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.15G019100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP114.84.8e-36129205177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +Cqv+gCe+d+se+k yh+rh++C  +++a++v+++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k 
  Manes.15G019100.1.p 129 RCQVPGCEVDISELKGYHKRHRICLCCANASAVVLDGENKRYCQQCGKFHLLSDFDEGKRSCRRKLERHNRRRRRKP 205
                          6************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-27123191IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.752127204IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.92E-33128208IPR004333Transcription factor, SBP-box
PfamPF031107.7E-27130204IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 775 aa     Download sequence    Send to blast
MEPSSPISPG APRPNLDDME IHLPVPEDPS SSAIWDWGDL LDFTIDDHFP ISFDDADILT  60
DVVSQVDPIE ETPVPDRVRK RDPRSTCSNF LAGRVPCACP ELDEKLEEEE DVPGRKRVRT  120
SRSSTGVARC QVPGCEVDIS ELKGYHKRHR ICLCCANASA VVLDGENKRY CQQCGKFHLL  180
SDFDEGKRSC RRKLERHNRR RRRKPRDSTE VVDKDPQGEL LSEDAARDGA TEKDHQIVEK  240
ETLVESEDGK VSSPQSAPSS QNLNTDSGAS VGTPKDGGKD DSKFAYSPFN RENKSFYSSA  300
CPTGRISFKL YDWNPAEFPR RLRLQIFEWL ASMPVELEGY VRPGCTILTA FLSMPSFMWE  360
KLFQDPLSYV HDFVIVPGTL LSKRSPMLIY LNDMIFHVLK DGNSLLKANM EVQAPRLHYV  420
HPTCFEAGKP IEFVACGSNL LQPKFRLLVS FAGKYLAYDH CVALPHGHTE ECSRLDHQLC  480
KIFIPNVEPN LFGPAFIEVE NESGLSNFVP VLIGDREICS EMKIIQHRLG LSLLGSQCEV  540
AVHRQRAFSE LVVDIAWVLK KPSSESFHQS MSSSQIQRLN SLLSLLIHHE STAILDKILK  600
NLKSILEEME KDRVAYDMND SEMSLLQKYM DSASDICHQK VKKRDGLAIQ WECAVDESEF  660
RCSEIDMPSV APFMNEDLEK SSNSNRKTGE MLNSSAVDRV PLLSEELVMN VNLRKECPTR  720
SCSLSFSNRV LKSRPTVFLI ATFALCLGVC AILLHPNQVS KFAVSIRRCL TQRI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A4e-42127212388squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186204KRSCRRKLERHNRRRRRKP
2190202RRKLERHNRRRRR
3199205RRRRKPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069441.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLA0A067KYI10.0A0A067KYI1_JATCU; Uncharacterized protein
STRINGPOPTR_0008s20160.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64703450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7